PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00001.225
Common NameAMTR_s00001p00217560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 231aa    MW: 27214.9 Da    PI: 9.0023
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00001.225genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF871e-27959151
                                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                              krien +nrqvt+skRr gi+KKA+EL vLCdaev++i+fsstgk+ ey+s
  evm_27.model.AmTr_v1.0_scaffold00001.225  9 KRIENPTNRQVTYSKRRGGIIKKAKELTVLCDAEVSLIMFSSTGKFSEYCS 59
                                              79***********************************************96 PP

2K-box66.31.1e-229417915100
                                     K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 
                                               +++q++l +Lk+e + L++ +R+ +Ged+++L++keL+ Leq+Le+ +k+iR+kKn+l+++q+e+ +k+
  evm_27.model.AmTr_v1.0_scaffold00001.225  94 QKMQRDLGNLKEESNRLRKLIRQKMGEDINELKYKELRDLEQNLEEWVKRIRDKKNHLVTNQTETCKKR 162
                                               89******************************************************************* PP

                                     K-box  84 ekelqeenkaLrkklee 100
                                                k+l+e+nk++r+++ee
  evm_27.model.AmTr_v1.0_scaffold00001.225 163 IKNLEEQNKMMRHMMEE 179
                                               ************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.903161IPR002100Transcription factor, MADS-box
CDDcd002653.25E-41280No hitNo description
SuperFamilySSF554551.96E-37290IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-283859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.80393183IPR002487Transcription factor, K-box
PfamPF014861.0E-2094177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MGRGKIEIKR IENPTNRQVT YSKRRGGIIK KAKELTVLCD AEVSLIMFSS TGKFSEYCSP  60
STSTKKIYDR YQQVSETNLW DTHYEENGFF LVLQKMQRDL GNLKEESNRL RKLIRQKMGE  120
DINELKYKEL RDLEQNLEEW VKRIRDKKNH LVTNQTETCK KRIKNLEEQN KMMRHMMEED  180
EAERGLEDDG DYESQLALGV RNTHLFAYRM RPAEGNIHDR GYGLNDLRLG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-16176174Myocyte-specific enhancer factor 2B
1tqe_Q1e-16176174Myocyte-specific enhancer factor 2B
1tqe_R1e-16176174Myocyte-specific enhancer factor 2B
1tqe_S1e-16176174Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3377430.0AY337743.1 Amborella trichopoda APETALA3-like protein AP3-1 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011628954.11e-160PREDICTED: MADS-box transcription factor 16
SwissprotQ944S91e-71MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBLW1NLE91e-171W1NLE9_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr9P20950_0018e-84(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP51991121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.12e-55MIKC_MADS family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]